HPA016592

LMBR1 antibody from Sigma-Aldrich
ACHP, C7orf2, FLJ11665, ZRS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016592
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016592, RRID:AB_1852943
Product name
Anti-LMBR1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016592
Antibody type
Polyclonal
Antigen
Limb region 1 protein homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FTVMGQLLVKPTILEDLDEQIYIITLEEEALQRRL
NGLSSSVEYNIMELEQELENVKTLKTKLERRKKAS
AWERN
Storage
-20C
Provider Type Product Number
- No reagents -