PAB29410
antibody from Abnova Corporation
Targeting: SYNE2
DKFZP434H2235, KIAA1011, Nesp2, Nesprin-2, NUA, NUANCE, SYNE-2
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB29410 - Provider product page
- Provider
- Abnova Corporation
- Product name
- SYNE2 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant human SYNE2.
- Antigen sequence
NVLNDAYENLTRYKEAVTRAVESITSLEAIIIPYR
VDVGNPEESLEMPLRKQEELESTVARIQDLTEKLG
MISSPEAKLQLQYTLQELVSKNSAMKEAFKAQETE
AE- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG with SYNE2 polyclonal antibody (Cat # PAB29410) at 1-4 ug/mL concentration shows positivity in nucleus and nuclear membrane.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney with SYNE2 polyclonal antibody (Cat # PAB29410) shows strong nuclear membrane positivity in cells in tubules at 1:200-1:500 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)