HPA003435

SYNE2 antibody from Atlas Antibodies
DKFZP434H2235, KIAA1011, Nesp2, Nesprin-2, NUA, NUANCE, SYNE-2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003435
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003435, RRID:AB_1080162
Product name
Anti-SYNE2
Provider product page
Atlas Antibodies - HPA003435
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NVLNDAYENLTRYKEAVTRAVESITSLEAIIIPYR
VDVGNPEESLEMPLRKQEELESTVARIQDLTEKLG
MISSPEAKLQLQYTLQELVSKNSAMKEAFKAQETE
AE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -