HPA003435

SYNE2 antibody from Sigma-Aldrich
DKFZP434H2235, KIAA1011, Nesp2, Nesprin-2, NUA, NUANCE, SYNE-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003435
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003435, RRID:AB_1080162
Product name
Anti-SYNE2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003435
Antibody type
Polyclonal
Antigen
Nesprin-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NVLNDAYENLTRYKEAVTRAVESITSLEAIIIPYR
VDVGNPEESLEMPLRKQEELESTVARIQDLTEKLG
MISSPEAKLQLQYTLQELVSKNSAMKEAFKAQETE
AE
Storage
-20C
Provider Type Product Number
- No reagents -