HPA008902

URB2 antibody from Sigma-Aldrich
KIAA0133, NET10, NPA2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008902
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008902, RRID:AB_2213805
Product name
Anti-URB2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008902
Antibody type
Polyclonal
Antigen
Unhealthy ribosome biogenesis protein 2 homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLGPFLKEQKLGQEAPAALSELLQQVVLQTGAVLQ
LCSVPGARGWRLPSVLISSVSTLLEADLGQHCRDG
GADISQGSDRTLLSHVALYQGVYSQILLELPALAG
HDQSFQAALQFLTLFFLAPELHPKKDSVFTSMFHS
Storage
-20C
Provider Type Product Number
- No reagents -