HPA030330

GPR32 antibody from Sigma-Aldrich
RVDR1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030330
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA030330, RRID:AB_10600706
Product name
Anti-GPR32 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA030330
Antibody type
Polyclonal
Antigen
G protein-coupled receptor 32 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KWNGCTHCYLAFNSDNETAQIWIEGVVEGHIIG
Storage
-20C
Provider Type Product Number
- No reagents -