HPA021282

DPP7 antibody from Atlas Antibodies
DPP2, DPPII
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021282
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021282, RRID:AB_1847673
Product name
Anti-DPP7
Provider product page
Atlas Antibodies - HPA021282
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MFARNAFTVLAMMDYPYPTDFLGPLPANPVKVGCD
RLLSEAQRITGLRALAGLVYNASGSEHCYDIYRLY
H
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -