HPA021282

DPP7 antibody from Sigma-Aldrich
DPPII
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021282
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021282, RRID:AB_1847673
Product name
Anti-DPP7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021282
Antibody type
Polyclonal
Antigen
Dipeptidyl-peptidase 2 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MFARNAFTVLAMMDYPYPTDFLGPLPANPVKVGCD
RLLSEAQRITGLRALAGLVYNASGSEHCYDIYRLY
H
Storage
-20C
Provider Type Product Number
- No reagents -