Antibody data

Product number
PAB30082
Provider
Abnova Corporation
Product name
FOXE3 polyclonal antibody
Provider product page
Abnova Corporation - PAB30082
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against synthetic peptide of human FOXE3.
Antigen sequence
PEPPCCAAPDAAAAAFPPCAAAASPPLYSQVPDRL
VLPATRPGPGPLPAE
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -