ABIN182529

FOXE3 antibody from antibodies-online
FKHL12, FREAC8
Western blot
Data presented on provider website
Immunohistochemistry
Recommended by provider

Antibody data

Product number
ABIN182529
Provider
antibodies-online
Product name
anti-Forkhead Box E3 (FOXE3) (C-Term) antibody
Provider product page
antibodies-online - ABIN182529
Antibody type
Polyclonal
Antigen
The immunogen for anti-FOXE3 antibody: synthetic peptide directed towards the C terminal of human FOXE3
Description
Affinity Purified
Reactivity
Human
Host
Rabbit
Antigen sequence
PEPPCCAAPDAAAAAFPPCAAAASPPLYSQVPDRL
VLPAT RPGPGPLPAE
Epitope
C-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -