HPA019082

CIT antibody from Atlas Antibodies
CITK, CRIK, KIAA0949, STK21
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019082
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019082, RRID:AB_1846803
Product name
Anti-CIT
Provider product page
Atlas Antibodies - HPA019082
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MKVPRNNKRGQQGWDRKYIVLEGSKVLIYDNEARE
AGQRPVEEFELCLPDGDVSIHGAVGASELANTAKA
DVPYILKMESHPHTTCWPGRTLYLL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -