HPA008344

SUN3 antibody from Sigma-Aldrich
MGC33329, SUNC1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008344
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008344, RRID:AB_1857656
Product name
Anti-SUNC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008344
Antibody type
Polyclonal
Antigen
Sad1/unc-84 domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TDVPQKSRQLYAIIAEYGSRLYKYQARLRMPKEQL
ELLKKESQNLENNFRQILFLIEQIDVLKALLRDMK
DGMDNNHNWNTHGDPVEDPDHTEEVSNLVN
Storage
-20C
Provider Type Product Number
- No reagents -