HPA024512

KLHL6 antibody from Sigma-Aldrich
FLJ00029
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024512
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024512, RRID:AB_2131015
Product name
Anti-KLHL6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024512
Antibody type
Polyclonal
Antigen
Kelch-like protein 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GDVVEKSLEGPLAPSTDEPSQKTGDLVEILNGEKV
KFDDAGLSLILQNGLETLRMENALTDVILCVDIQE
FSCHRVVLAAASNYFRAM
Storage
-20C
Provider Type Product Number
- No reagents -