H00023353-B02

SUN1 antibody from Abnova Corporation
FLJ12407, KIAA0810, UNC84A

Antibody data

Product number
H00023353-B02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023353-B02, RRID:AB_1205157
Product name
UNC84A MaxPab mouse polyclonal antibody (B02)
Provider product page
Abnova Corporation - H00023353-B02
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human UNC84A protein.
Antigen sequence
MDFSRLHMYSPPQCVPENTGYTYALSSSYSSDALD
FETEHKLDPVFDSPRMSRRSLRLATTACTLGDGEA
VGADSGTSSAVSLKNRAARTTKQRRSTNKSAFSIN
HVSRQVTSSGVSHGGTVSLQDAVTRRPPVLDESWI
REQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGAA
AATAHNGFSCSNCSMLSERKDVLTAHPAPPGPVSR
VYSRDRNQKCKSQSFKTQKKVCFPNLIFPFCKSQC
LHYLSWRLKIIP
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -