Antibody data
- Antibody Data
- Antigen structure
- References [7]
- Comments [0]
- Validations
- Immunocytochemistry [2]
- Immunohistochemistry [12]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA008346 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA008346, RRID:AB_1080462
- Product name
- Anti-SUN1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
QLLPTVEHLQLELDQLKSELSSWRHVKTGCETVDA
VQERVDVQVREMVKLLFSEDQQGGSLEQLLQRFSS
QFVSKGDLQTMLRDLQLQILRNVTHHVSVTKQLPT
SEAVVSAVSEAGASGITEAQARAIVNS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Muscular dystrophy-associated SUN1 and SUN2 variants disrupt nuclear-cytoskeletal connections and myonuclear organization.
A mammalian KASH domain protein coupling meiotic chromosomes to the cytoskeleton
Human telomeres are tethered to the nuclear envelope during postmitotic nuclear assembly.
Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy
Samp1 is functionally associated with the LINC complex and A-type lamina networks
Induction of a massive endoplasmic reticulum and perinuclear space expansion by expression of lamin B receptor mutants and the related sterol reductases TM7SF2 and DHCR7.
Membrane Insertion of the Pleckstrin Homology Domain Variable Loop 1 Is Critical for Dynamin-catalyzed Vesicle Scission
Meinke P, Mattioli E, Haque F, Antoku S, Columbaro M, Straatman KR, Worman HJ, Gundersen GG, Lattanzi G, Wehnert M, Shackleton S
PLoS genetics 2014 Sep;10(9):e1004605
PLoS genetics 2014 Sep;10(9):e1004605
A mammalian KASH domain protein coupling meiotic chromosomes to the cytoskeleton
Horn H, Kim D, Wright G, Wong E, Stewart C, Burke B, Roux K
The Journal of Cell Biology 2013 September;202(7):1023-1039
The Journal of Cell Biology 2013 September;202(7):1023-1039
Human telomeres are tethered to the nuclear envelope during postmitotic nuclear assembly.
Crabbe L, Cesare AJ, Kasuboski JM, Fitzpatrick JA, Karlseder J
Cell reports 2012 Dec 27;2(6):1521-9
Cell reports 2012 Dec 27;2(6):1521-9
Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy
Stadler C, Hjelmare M, Neumann B, Jonasson K, Pepperkok R, Uhlén M, Lundberg E
Journal of Proteomics 2012 April;75(7):2236-2251
Journal of Proteomics 2012 April;75(7):2236-2251
Samp1 is functionally associated with the LINC complex and A-type lamina networks
Gudise S, Figueroa R, Lindberg R, Larsson V, Hallberg E
Journal of Cell Science 2011 May;124(12):2077-2085
Journal of Cell Science 2011 May;124(12):2077-2085
Induction of a massive endoplasmic reticulum and perinuclear space expansion by expression of lamin B receptor mutants and the related sterol reductases TM7SF2 and DHCR7.
Zwerger M, Kolb T, Richter K, Karakesisoglou I, Herrmann H
Molecular biology of the cell 2010 Jan 15;21(2):354-68
Molecular biology of the cell 2010 Jan 15;21(2):354-68
Membrane Insertion of the Pleckstrin Homology Domain Variable Loop 1 Is Critical for Dynamin-catalyzed Vesicle Scission
Ramachandran R, Pucadyil T, Liu Y, Acharya S, Leonard M, Lukiyanchuk V, Schmid S
Molecular Biology of the Cell 2009 November;20(22):4630-4639
Molecular Biology of the Cell 2009 November;20(22):4630-4639
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- 55af80e3e0991
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Confocal images of immunofluorescently stained human U-2 OS cells.The protein SUN1 is shown in green. The image to the left show cells transfected with control siRNA and the image to the right show cells where SUN1 has been downregulated with specific siRNA.
- Sample type
- U-2 OS cells
- Primary Ab dilution
- 1:59
- Secondary Ab
- Secondary Ab
- Secondary Ab dilution
- 1:800
- Knockdown/Genetic Approaches Application
- Immunocytochemistry
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows positivity in nuclear membrane.
- Sample type
- HUMAN
Enhanced validation
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human skin and bone marrow tissues using HPA008346 antibody. Corresponding SUN1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube, kidney, skin and testis using Anti-SUN1 antibody HPA008346 (A) shows similar protein distribution across tissues to independent antibody HPA008461 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows strong nuclear membrane positivity in trophoblastic cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows low expression as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon using Anti-SUN1 antibody HPA008346.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node using Anti-SUN1 antibody HPA008346.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human bone marrow shows low positivity in hematopoietic cells as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows strong positivity in nuclear membrane in squamous epithelial cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong positivity in nuclear membrane in cells in glomeruli.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong positivity in nuclear membrane in Leydig cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human Fallopian tube shows moderate positivity in nuclear membrane in glandular cells.
- Sample type
- HUMAN