HPA008461

SUN1 antibody from Atlas Antibodies
FLJ12407, KIAA0810, UNC84A
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008461
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008461, RRID:AB_1080461
Product name
Anti-SUN1
Provider product page
Atlas Antibodies - HPA008461
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QGNFFSFLPVLNWASMHRTQRVDDPQDVFKPTTSR
LKQPLQGDSEAFPWHWMSGVEQQVASLSGQCHHHG
ENLRELTTLLQKLQARVDQMEGGAAGPSASVRDAV
GQPPRETDFMAFHQEHEVRMSHLEDILGKLR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -