HPA008461

SUN1 antibody from Sigma-Aldrich
FLJ12407, KIAA0810, UNC84A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008461
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008461, RRID:AB_1080461
Product name
Anti-UNC84A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008461
Antibody type
Polyclonal
Antigen
Sad1/unc-84 protein-like 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QGNFFSFLPVLNWASMHRTQRVDDPQDVFKPTTSR
LKQPLQGDSEAFPWHWMSGVEQQVASLSGQCHHHG
ENLRELTTLLQKLQARVDQMEGGAAGPSASVRDAV
GQPPRETDFMAFHQEHEVRMSHLEDILGKLR
Storage
-20C
Provider Type Product Number
- No reagents -