HPA024231

KCNJ3 antibody from Sigma-Aldrich
GIRK1, KGA, Kir3.1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024231
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024231, RRID:AB_1855558
Product name
Anti-KCNJ3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024231
Antibody type
Polyclonal
Antigen
G protein-activated inward rectifier potassium channel 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VPTPPYSVKEQEEMLLMSSPLIAPAITNSKERHNS
VECLDGLDDITTKLPSKLQKITGREDFPKKLLRMS
STTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKT
TKMLSDPMSQSVADLPPKLQKMAGGAARMEGN
Storage
-20C
Provider Type Product Number
- No reagents -