H00009622-M09

KLK4 antibody from Abnova Corporation
EMSP, EMSP1, KLK-L1, PRSS17, PSTS

Antibody data

Product number
H00009622-M09
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009622-M09, RRID:AB_1137275
Product name
KLK4 monoclonal antibody (M09), clone 2A4
Provider product page
Abnova Corporation - H00009622-M09
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant KLK4.
Antigen sequence
GRMPTVLQCVNVSVVSEEVCSKLYDPLYHPSMFCA
GGGQDQKDSCNGDSGGPLICNGYLQGLVSFGKAPC
GQVGVPGVYTNLCKFTEWIEKTVQAS
Isotype
IgG
Antibody clone number
2A4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -