HPA019545

PARL antibody from Atlas Antibodies
PRO2207, PSARL, PSARL1, RHBDS1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019545
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019545, RRID:AB_1669685
Product name
Anti-PARL
Provider product page
Atlas Antibodies - HPA019545
Antibody type
Polyclonal
Antigen
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ESLKSRVQSYFDGIKADWLDSIRPQKEGDFRKEIN
KWWNNLSDGQR
Isotype
IgG
Vial size (┬Ál)
100μl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -