Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310637 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Presenilin Associated, Rhomboid-Like (PARL) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PARL antibody: synthetic peptide directed towards the N terminal of human PARL
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
SLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSY
FDGIK ADWLDSIRPQ- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The role of PARL and HtrA2 in striatal neuronal injury after transient global cerebral ischemia.
The mitochondrial rhomboid protease PSARL is a new candidate gene for type 2 diabetes.
Yoshioka H, Katsu M, Sakata H, Okami N, Wakai T, Kinouchi H, Chan PH
Journal of cerebral blood flow and metabolism : official journal of the International Society of Cerebral Blood Flow and Metabolism 2013 Nov;33(11):1658-65
Journal of cerebral blood flow and metabolism : official journal of the International Society of Cerebral Blood Flow and Metabolism 2013 Nov;33(11):1658-65
The mitochondrial rhomboid protease PSARL is a new candidate gene for type 2 diabetes.
Walder K, Kerr-Bayles L, Civitarese A, Jowett J, Curran J, Elliott K, Trevaskis J, Bishara N, Zimmet P, Mandarino L, Ravussin E, Blangero J, Kissebah A, Collier GR
Diabetologia 2005 Mar;48(3):459-68
Diabetologia 2005 Mar;48(3):459-68
No comments: Submit comment
No validations: Submit validation data