HPA019545

PARL antibody from Sigma-Aldrich
PRO2207, PSARL, PSARL1, RHBDS1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019545
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019545, RRID:AB_1855796
Product name
Anti-PARL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019545
Antibody type
Polyclonal
Antigen
Presenilins-associated rhomboid-like protein, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ESLKSRVQSYFDGIKADWLDSIRPQKEGDFRKEIN
KWWNNLSDGQR
Storage
-20C
Provider Type Product Number
- No reagents -