HPA018253

FAF1 antibody from Sigma-Aldrich
CGI-03, hFAF1, HFAF1s, UBXD12, UBXN3A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018253
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018253, RRID:AB_1848351
Product name
Anti-FAF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018253
Antibody type
Polyclonal
Antigen
FAS-associated factor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IPVSKMLLKGWKTGDVEDSTVLKSLHLPKNNSLYV
LTPDLPPPSSSSHAGALQESLNQNFMLIITHREVQ
REYNLNFS
Storage
-20C
Provider Type Product Number
- No reagents -