HPA018994

KLK7 antibody from MilliporeSigma / Merck KGaA
PRSS6, SCCE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018994
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA018994, RRID:AB_1852607
Product name
Anti-KLK7 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA018994
Antibody type
Polyclonal
Antigen
Kallikrein-7 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPS
DLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDS
KKNACNGDSGGPLVCR
Storage
-20C
Provider Type Product Number
- No reagents -