HPA012072

LASP1 antibody from Sigma-Aldrich
Lasp-1, MLN50
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012072
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012072, RRID:AB_1852714
Product name
Anti-LASP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012072
Antibody type
Polyclonal
Antigen
LIM and SH3 domain protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSV
VADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSG
GEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPV
YQQPQQQPVAQSYGGYKE
Storage
-20C
Provider Type Product Number
- No reagents -