Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA020899 - Provider product page

- Provider
- MilliporeSigma / Merck KGaA
- Product name
- Anti-C9orf75 antibody produced in rabbit
- Antibody type
- Polyclonal
- Antigen
- Uncharacterized protein C9orf75 recombinant protein epitope signature tag (PrEST)
- Description
- affinity isolated antibody
- Reactivity
- Human
- Antigen sequence
ADRAIRWQRPSSPPPFLPAASEEAEPAEGLRVPGL
AKNSREYVRPGLPVTFIDEVDSEEAPQAAKLPYLP- Storage
- -20C
Submitted references Targeted capture and next-generation sequencing identifies C9orf75, encoding taperin, as the mutated gene in nonsyndromic deafness DFNB79.
Rehman AU, Morell RJ, Belyantseva IA, Khan SY, Boger ET, Shahzad M, Ahmed ZM, Riazuddin S, Khan SN, Riazuddin S, Friedman TB
American journal of human genetics 2010 Mar 12;86(3):378-88
American journal of human genetics 2010 Mar 12;86(3):378-88
No comments: Submit comment
No validations: Submit validation data