Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00027158-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00027158-M01, RRID:AB_530140
- Product name
- NDOR1 monoclonal antibody (M01), clone 3A11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NDOR1.
- Antigen sequence
EWQELEKRDCLTLIPAFSREQEQKVYVQHRLRELG
SLVWELLDRQGAYFYLAGNAKSMPADVSEALMSIF
QEEGGLCSPDAAAYLARLQQTRRFQTET- Isotype
- IgG
- Antibody clone number
- 3A11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Diflavin oxidoreductases activate the bioreductive prodrug PR-104A under hypoxia.
Guise CP, Abbattista MR, Tipparaju SR, Lambie NK, Su J, Li D, Wilson WR, Dachs GU, Patterson AV
Molecular pharmacology 2012 Jan;81(1):31-40
Molecular pharmacology 2012 Jan;81(1):31-40
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of NDOR1 expression in transfected 293T cell line by NDOR1 monoclonal antibody (M01), clone 3A11.Lane 1: NDOR1 transfected lysate(66.8 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- NDOR1 monoclonal antibody (M01), clone 3A11. Western Blot analysis of NDOR1 expression in NIH/3T3(Cat # L018V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged NDOR1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol