HPA007923

MAGI3 antibody from Sigma-Aldrich
MAGI-3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007923
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007923, RRID:AB_1853503
Product name
Anti-MAGI3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007923
Antibody type
Polyclonal
Antigen
Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 (Membrane-associated guanylate kinase inverted 3) (MAGI-3)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LKVGDHISAVNGQSIVELSHDNIVQLIKDAGVTVT
LTVIAEEEHHGPPSGTNSARQSPALQHRPMGQSQA
NHIPGDRSALEGEIGKDVSTSYRHSWSDHKHLAQP
DTAVISVVGSRHNQNLGCYPVELERGPRGFGFSLR
G
Storage
-20C
Provider Type Product Number
- No reagents -