HPA019038

OR10S1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019038
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019038, RRID:AB_1854785
Product name
Anti-OR10S1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019038
Antibody type
Polyclonal
Antigen
Olfactory receptor 10S1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MTSRSVCEKMTMTTENPNQTVVSHFFLEGLRYTAK
HSSL
Storage
-20C
Provider Type Product Number
- No reagents -