HPA017010

PDLIM1 antibody from MilliporeSigma / Merck KGaA
CLIM1, CLP-36, CLP36, hCLIM1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017010
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA017010, RRID:AB_1855147
Product name
Anti-PDLIM1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA017010
Antibody type
Polyclonal
Antigen
PDZ and LIM domain protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EKQELNEPPKQSTSFLVLQEILESEEKGDPNKPSG
FRSVKAPVTKVAASIGNAQKLPMCDKCGTGIVGVF
VKLRDRHRHPECYVCTDCGTNLKQKGHFFVEDQIY
CEKHARERVTPPEGYEVVTV
Storage
-20C
Provider Type Product Number
- No reagents -