HPA017135

RNF10 antibody from MilliporeSigma / Merck KGaA
KIAA0262, RIE2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017135
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA017135, RRID:AB_1856316
Product name
Anti-RNF10 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA017135
Antibody type
Polyclonal
Antigen
RING finger protein 10 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
REKGVLVALPKSKWMNVDHPIHLGDEQHSQYSKLL
LASKEQVLHRVVLEEKVALEQQLAEEKHTPESCFI
EAAIQELKTREEALSGLAGSRREVTGVVAALEQLV
LM
Storage
-20C
Provider Type Product Number
- No reagents -