Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504582 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, epsilon Polypeptide (YWHAE) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-YWHAE antibody: synthetic peptide directed towards the middle region of human YWHAE
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
ELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDG
EEQNK EALQDVEDEN- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references 14-3-3epsilon inhibits MK5-mediated cell migration by disrupting F-actin polymerization.
Tak H, Jang E, Kim SB, Park J, Suk J, Yoon YS, Ahn JK, Lee JH, Joe CO
Cellular signalling 2007 Nov;19(11):2379-87
Cellular signalling 2007 Nov;19(11):2379-87
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting