HPA019487

KLK13 antibody from MilliporeSigma / Merck KGaA
KLK-L4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019487
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA019487, RRID:AB_1852600
Product name
Anti-KLK13 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA019487
Antibody type
Polyclonal
Antigen
Kallikrein-13 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QESSKVLNTNGTSGFLPGGYTCFPHSQPWQAALLV
QGRLLCGGVLVHPKWVLTAAHCLKE
Storage
-20C
Provider Type Product Number
- No reagents -