HPA027397

OSBPL9 antibody from Atlas Antibodies
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA027397
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027397, RRID:AB_1854817
Product name
Anti-OSBPL9
Provider product page
Atlas Antibodies - HPA027397
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PSPLEPVISTMPSQTVLPPEPVQLCKSEQRPSSLP
VGPVLATLGHHQTPTPNSTGSGHSPPSSSLTSPSH
VNLSPNTV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -