HPA027378

OSBPL9 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027378
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027378, RRID:AB_1854816
Product name
Anti-OSBPL9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027378
Antibody type
Polyclonal
Antigen
Oxysterol-binding protein-related protein 9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QGLDSGFVPSVQDFDKKLTEADAYLQILIEQLKLF
DDKLQNCKEDEQRKKIETLKETTNSMVESIKHCIV
LLQIAKDQSNAEKHADGM
Storage
-20C
Provider Type Product Number
- No reagents -