HPA008719

PLAU antibody from Sigma-Aldrich
UPA, URK
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008719
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008719, RRID:AB_1858635
Product name
Anti-PLAU antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008719
Antibody type
Polyclonal
Antigen
Urokinase-type plasminogen activator precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAH
HNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDP
QFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISH
RECQQPHYYGSEVTTKMLCAADPQWKTDSCQGD
Storage
-20C
Provider Type Product Number
- No reagents -