HPA020259

NELFB antibody from Atlas Antibodies
COBRA1, KIAA1182, NELF-B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020259
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020259, RRID:AB_1847072
Product name
Anti-NELFB
Provider product page
Atlas Antibodies - HPA020259
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KETLTNCTEPLKAIEQFQTENGVLLPSLQSALPFL
DLHGTPRLEFHQSVFDELRDKLLERVSAIASEGKA
EERYKKLED
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -