HPA020259

NELFB antibody from Sigma-Aldrich
COBRA1, KIAA1182, NELF-B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020259
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020259, RRID:AB_1847072
Product name
Anti-COBRA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020259
Antibody type
Polyclonal
Antigen
Negative elongation factor B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KETLTNCTEPLKAIEQFQTENGVLLPSLQSALPFL
DLHGTPRLEFHQSVFDELRDKLLERVSAIASEGKA
EERYKKLED
Storage
-20C
Provider Type Product Number
- No reagents -