HPA000694

DICER1 antibody from Atlas Antibodies
Dicer, HERNA, K12H4.8-LIKE, KIAA0928, MNG1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000694
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000694, RRID:AB_1078661
Product name
Anti-DICER1
Provider product page
Atlas Antibodies - HPA000694
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKS
EARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRN
FDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYK
TKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQK
GKALPLSSAEKRKAKWESLQNKQILVPELCAIHPI
PASLWRKAVCLPSILYRLH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -