AMAb90737
antibody from Atlas Antibodies
Targeting: DICER1
Dicer, HERNA, K12H4.8-LIKE, KIAA0928, MNG1
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
- Immunocytochemistry [1]
- Immunohistochemistry [7]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb90737 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb90737, RRID:AB_2665650
- Product name
- Anti-DICER1
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
PTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKS
EARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRN
FDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYK
TKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQK
GKALPLSSAEKRKAKWESLQNKQILVPELCAIHPI
PASLWRKAVCLPSILYRLH- Epitope
- Binds to an epitope located within the peptide sequence LSSAEKRKAK as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL0378
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-DICER1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa]Lane 2: Human cell line HEK293T
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis of extracts from RT-4 cells, transfected with: control siRNA, target specific siRNA probe #1, target specific siRNA probe #2, using Anti-DICER monoclonal antibody. Downregulation of antibody signal confirms target specificity. Remaining % intensity, relative control lane, is indicated. Anti-GAPDH monoclonal antibody was used as loading control.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of A-431 cells using the anti-DICER1 monoclonal antibody, showing specific staining in the cytosol in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human uterus shows cytoplasmic immunoreactivity in the glandular epithelium cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows cytoplasmic positivity in the seminiferous tubules cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows cytoplasmic immunoreactivity in the glandular epithelium cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows cytoplasmic positivity in the glial cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colorectal cancer (adenocarcinoma) shows cytoplasmic positivity in cancer cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lung cancer (adenocacrinoma) shows strong cytoplasmic positivity in cancer cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human breast cancer (ductal carcinoma) shows moderate cytoplasmic positivity in cancer cells.