HPA000694

DICER1 antibody from Sigma-Aldrich
Dicer, HERNA, K12H4.8-LIKE, KIAA0928, MNG1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000694
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000694, RRID:AB_1078661
Product name
Anti-DICER1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000694
Antibody type
Polyclonal
Antigen
Endoribonuclease Dicer recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKS
EARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRN
FDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYK
TKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQK
GKALPLSSAEKRKAKWESLQNKQILVPELCAIHPI
PASLWRKAVCLPSILYRLH
Storage
-20C
Provider Type Product Number
- No reagents -