Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PA1-31286 - Provider product page
- Provider
- Invitrogen Antibodies
- Product name
- Anti-CHX10 Polyclonal Antibody
- Antibody type
- Polyclonal
- Antigen
- Recombinant protein fragment
- Description
- PA1-31286 detects CHX10 from bovine, rat, human, mouse samples. PA1-31286 has been successfully used in Western blot applications. The PA1-31286 immunogen is: Recombinant fragment: EAAAEKPEGERQALPKLDKMEQDERGPDAQAAISQEELRENSIAVLRAKAQEHSTKVLGTVSGPDSLARSTEKPEEEEAMDEDRPAERLSPPQLEDMA, corresponding to C terminal amino acids 264-361 of Human CHX10.
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Sheep
- Isotype
- IgG
- Vial size
- 250 µg
- Concentration
- 1 mg/ml
- Storage
- Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
No comments: Submit comment
No validations: Submit validation data