HPA003436

VSX2 antibody from Sigma-Aldrich
CHX10, HOX10, RET1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003436
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003436, RRID:AB_1078523
Product name
Anti-VSX2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003436
Antibody type
Polyclonal
Antigen
Visual system homeobox 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LGLNKEPPSSHPRAALDGLAPGHLLAARSVLSPAG
VGGMGLLGPGGLPGFYTQPTFLEVLSDPQSVHLQP
LGRASGPLDTSQTASSDSEDVSSSDRKMSKSALNQ
TKKRKKRRHRTIFTSYQLEELEKAFNEAH
Storage
-20C
Provider Type Product Number
- No reagents -