HPA025729

NRARP antibody from Atlas Antibodies
MGC61598
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA025729
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA025729, RRID:AB_1854633
Product name
Anti-NRARP
Provider product page
Atlas Antibodies - HPA025729
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQ
NMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLL
VKFGADIRLANRDGWSALHIAAF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -