HPA025729

NRARP antibody from Sigma-Aldrich
MGC61598
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025729
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025729, RRID:AB_1854633
Product name
Anti-NRARP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025729
Antibody type
Polyclonal
Antigen
Notch-regulated ankyrin repeat-containing protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQ
NMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLL
VKFGADIRLANRDGWSALHIAAF
Storage
-20C
Provider Type Product Number
- No reagents -