Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406714 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Actin Related Protein 2/3 Complex, Subunit 2, 34kDa (ARPC2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ARPC2 antibody: synthetic peptide directed towards the N terminal of human ARPC2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Porcine, Xenopus
- Host
- Rabbit
- Antigen sequence
MVLNVYCCFFQISDIQTMKINQTILKEFILVGFSV
YPHVQ TFLFVVFFCL- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Proteomic analysis identifies an NADPH oxidase 1 (Nox1)-mediated role for actin-related protein 2/3 complex subunit 2 (ARPC2) in promoting smooth muscle cell migration.
Coronin 1B coordinates Arp2/3 complex and cofilin activities at the leading edge.
Al Ghouleh I, Rodríguez A, Pagano PJ, Csányi G
International journal of molecular sciences 2013 Oct 11;14(10):20220-35
International journal of molecular sciences 2013 Oct 11;14(10):20220-35
Coronin 1B coordinates Arp2/3 complex and cofilin activities at the leading edge.
Cai L, Marshall TW, Uetrecht AC, Schafer DA, Bear JE
Cell 2007 Mar 9;128(5):915-29
Cell 2007 Mar 9;128(5):915-29
No comments: Submit comment
No validations: Submit validation data