HPA008352

ARPC2 antibody from Atlas Antibodies
ARC34, p34-Arc
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008352
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008352, RRID:AB_1854887
Product name
Anti-ARPC2
Provider product page
Atlas Antibodies - HPA008352
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAP
QVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRH
TNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRM
RAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -