HPA008352

ARPC2 antibody from Sigma-Aldrich
ARC34, p34-Arc
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008352
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008352, RRID:AB_1854887
Product name
Anti-ARPC2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008352
Antibody type
Polyclonal
Antigen
Actin-related protein 2/3 complex subunit 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAP
QVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRH
TNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRM
RAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR
Storage
-20C
Provider Type Product Number
- No reagents -