HPA018910

ETFB antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018910
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018910, RRID:AB_1848280
Product name
Anti-ETFB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018910
Antibody type
Polyclonal
Antigen
Electron transfer flavoprotein subunit beta recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKK
KKIEVIKPGDLGVDLTSKLSVISVEDPPQRTAGVK
VETTEDLVAKLKEIGRI
Storage
-20C
Provider Type Product Number
- No reagents -