HPA018921

ETFB antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018921
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA018921, RRID:AB_1848281
Product name
Anti-ETFB antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA018921
Antibody type
Polyclonal
Antigen
Electron transfer flavoprotein subunit beta recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ETIRTALAMGADRGIHVEVPPAEAERLGPLQVARV
LAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFL
DWPQGTFASQVTLEGDKLKVEREID
Storage
-20C
Provider Type Product Number
- No reagents -